Report for Sequence Feature Glyma05g26920
Feature Type: gene_model
Chromosome: Gm05
Start: 32804541
stop: 32807733
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma05g26920
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G01890 AT
Annotation by Michelle Graham. TAIR10: purple acid phosphatase 8 | chr2:396985-399168 REVERSE LENGTH=335
SoyBase E_val: 2.00E-129 ISS
GO:0010167 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to nitrate
SoyBase N/A ISS
GO:0015706 GO-bp
Annotation by Michelle Graham. GO Biological Process: nitrate transport
SoyBase N/A ISS
GO:0016311 GO-bp
Annotation by Michelle Graham. GO Biological Process: dephosphorylation
SoyBase N/A ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0003993 GO-mf
Annotation by Michelle Graham. GO Molecular Function: acid phosphatase activity
SoyBase N/A ISS
GO:0004722 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine phosphatase activity
SoyBase N/A ISS
GO:0016787 GO-mf
Annotation by Michelle Graham. GO Molecular Function: hydrolase activity
SoyBase N/A ISS
KOG2679
KOG
Purple (tartrate-resistant) acid phosphatase
JGI ISS
PTHR10161 Panther
ACID PHOSPHATASE-RELATED
JGI ISS
PF00149 PFAM
Calcineurin-like phosphoesterase
JGI ISS
UniRef100_Q8VYZ2 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Purple acid phosphatase 8 n=1 Tax=Arabidopsis thaliana RepID=PPA8_ARATH
SoyBase E_val: 7.00E-127 ISS
UniRef100_UPI0002339B11 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI0002339B11 related cluster n=1 Tax=unknown RepID=UPI0002339B11
SoyBase E_val: 0 ISS
Proteins Associated with Glyma05g26920
Locus Gene Symbol Protein Name
PAP7 Purple acid phosphatase 7 gene
PAP7 Purple acid phosphatase gene 7
Expression Patterns of Glyma05g26920
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma05g26920
Paralog Evidence Comments
Glyma08g09880 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma05g26920 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.05g138300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma05g26920
Coding sequences of Glyma05g26920
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma05g26920.2 sequence type=CDS gene model=Glyma05g26920 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGGGATGCAGCTTGTTTTCATTGGCACCATAGCCTTGTGTTTGGTTGTTTCCTCGGCTATGCTTGAGCAGTTTGAACAAGCACCTAAACAAGATGGATCGCTTAGCTTCTTGGTAGTGGACAAACTAGTGGCCACCGATACAGCAGAGAAACCCCAAACAGTTATAGCAGAGGAGGAGCAGCCAATGAATATCGTGCTTTTCCTTGCTATACAAAGTGGTCACTGCATAGATGATCCAGCCTTTGATGACTCATTCACCAAAATCTACACTGCTTCTAGCTTGCAAAAGCAATGGTACAGTGTTTTGGGCAACCACGACTATAGGGGTAATGTTGAGGCACGGTTGAGTCCTGTCCTCACAAATCTTGACAAGAGATGGCTTTGCTTGAGATCTTTTACTGTAAATGCAGAAGTTGCAGAGTTTTACTTTGTAGATACTACTCCGTTTGTGGACAAATACTTCACAGAACCTAAGGACATGTCTATATATGATTGGAGTGGCATATTGCCTAGGAAACAATACATTTCCAACCTCCTCAAGGACGTGGATTTGGCTTTACAACAATCAAATGCAAAATGGAAGATTGTGGTGGGTCACCATACAATTAGAAGTGCCGGCTTGCACGGTAATACGGATGAGCTTGTAAAGCAGCTTCTCCCAATTCTTGAGGCAAACAACATTGATCTTTACATAAATGGACAGGATCACTGCCTACAACACATAGGCAGTCTTGGCAGTGCAATTCAATTTTTGGCTAGCGGGGGAGGGTCAAAGGCTTGGAGGGGTGTTGTGAACTGGTGGAAGCCAGAAGAGATGAAGTTCTACTACGATGGCCAAGGATTCATGTCTGTGAAGATCACCGAAACTGAAATTGACATAGTATTCTATGATGTCTATGGCCATGTTCTACACAAATGGAACGCATCCTAA
Predicted protein sequences of Glyma05g26920
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma05g26920.2 sequence type=predicted peptide gene model=Glyma05g26920 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MGMQLVFIGTIALCLVVSSAMLEQFEQAPKQDGSLSFLVVDKLVATDTAEKPQTVIAEEEQPMNIVLFLAIQSGHCIDDPAFDDSFTKIYTASSLQKQWYSVLGNHDYRGNVEARLSPVLTNLDKRWLCLRSFTVNAEVAEFYFVDTTPFVDKYFTEPKDMSIYDWSGILPRKQYISNLLKDVDLALQQSNAKWKIVVGHHTIRSAGLHGNTDELVKQLLPILEANNIDLYINGQDHCLQHIGSLGSAIQFLASGGGSKAWRGVVNWWKPEEMKFYYDGQGFMSVKITETEIDIVFYDVYGHVLHKWNAS*